PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G078300.2.p
Common NameLOC101782113, SETIT_036187mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 274aa    MW: 27146 Da    PI: 9.1188
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G078300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.7e-32113166255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Seita.9G078300.2.p 113 PRMRWTTALHARFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 166
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575124No hitNo description
Gene3DG3DSA:1.10.10.604.3E-29111167IPR009057Homeodomain-like
SuperFamilySSF466895.55E-16111167IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-24113166IPR006447Myb domain, plants
PfamPF002493.5E-8114165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MLQRNLPNLS LGISPPAASS AAACDALAVA RPPLAEPSTA PHAEGSGEVG FFANPSPVAE  60
PPGLSLGLGT PAARGGDAAG RRGHLEPQGC AFKRAATRAS LPGGSTKRSA RAPRMRWTTA  120
LHARFVHAVE LLGGHERATP KSVLELMNVK DLTLAHVKSH LQMYRTVKST DRSLHIATGE  180
ALPLQRTTAT GMEAAAAAAA AGGGAAAGGG VVVVPVPAAC DDMVGICSSP SAGSAPPAAA  240
TTSAAHFLCA PPATAPLAAA PPPPPPIPPS TQD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0651241e-153BT065124.1 Zea mays full-length cDNA clone ZM_BFb0205B22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981643.10.0PREDICTED: probable transcription factor RL9
TrEMBLK4ABD00.0K4ABD0_SETIT; Uncharacterized protein
STRINGSi036187m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.25e-38G2-like family protein